MS-Fit Search Results

Press stop on your browser if you wish to abort this MS-Fit search prematurely.
Sample ID (comment): HSG075
Database searched: SwissProt.8.20.2001
Molecular weight search (1000 - 100000 Da) selects 94194 entries.
Full pI range: 99754 entries.
Species search ( HUMAN MOUSE ) selects 11713 entries.
Combined molecular weight, pI and species searches select 10428 entries.
Pre searches select 10428 entries.
MS-Fit search selects 542 entries (results displayed for top 5 matches).

Parameters Used in Search

Considered modifications: | Oxidation of M | Protein N-terminus Acetylated | Acrylamide Modified Cys |

4	75.000 ppm	monoisotopic	Trypsin	1	carbamidomethylation	Hydrogen (H)	Free Acid (O H)
Min. # Peptides to Match	Peptide Mass Tolerance (+/-)	Peptide Masses are	Digest Used	Max. # Missed Cleavages	Cysteines Modified by	Peptide N terminus	Peptide C terminus

Result Summary

Rank	MOWSE Score	# (%) Masses Matched	Protein MW (Da)/pI	Species	Protein Name
1	3.86e+009	20/60 (33%)	41737.1 / 5.29	HUMAN	ACTIN, CYTOPLASMIC 1 (BETA-ACTIN)
2	3.85e+009	20/60 (33%)	41793.2 / 5.31	HUMAN	ACTIN, CYTOPLASMIC 2 (GAMMA-ACTIN)
3	2.07e+006	14/60 (23%)	42019.4 / 5.23	HUMAN	ACTIN, ALPHA CARDIAC
4	2.06e+006	14/60 (23%)	42051.4 / 5.23	HUMAN	ACTIN, ALPHA SKELETAL MUSCLE (ALPHA-ACTIN 1)
5	3.91e+005	12/60 (20%)	41877.3 / 5.31	HUMAN	ACTIN, GAMMA-ENTERIC SMOOTH MUSCLE (ALPHA-ACTIN 3)

Detailed Results

1. 20/60 matches (33%). 41737.1 Da, pI = 5.29. Acc. # P02570. HUMAN. ACTIN, CYTOPLASMIC 1 (BETA-ACTIN).

m/z submitted	MH⁺ matched	Delta ppm	start	end	Peptide Sequence (Click for Fragment Ions)	Modifications
644.3322	644.3731	-63.5738	178	183	(R)(D)
791.3130	791.3722	-74.8168	285	290	(K)CDVDIR(K)	1Cys-am
795.4146	795.4729	-73.2587	329	335	(K)(K)
800.4780	800.5358	-72.1728	62	68	(K)(Y)
919.4116	919.4671	-60.3502	285	291	(K)CDVDIRK(D)	1Cys-am
923.5008	923.5678	-72.5851	329	336	(K)(Y)
976.3865	976.4488	-63.8378	19	28	(K)(A)
1132.4567	1132.5275	-62.5244	197	206	(R)(E)
1198.6349	1198.7061	-59.3741	29	39	(R)(H)
1354.5480	1354.6239	-56.0260	51	62	(K)(G)
1515.6824	1515.7497	-44.4241	85	95	(K)(V)
1790.7887	1790.8925	-57.9356	239	254	(K)(F)
1835.7372	1835.8155	-42.6966	1	18	(-)DDDIAALVVDNGSGMCK(A)	1Cys-am Acet N
1953.9859	1954.0650	-40.4360	96	113	(R)(A)
2214.9895	2215.0705	-36.5764	292	312	(K)(M)
2230.9919	2231.0654	-32.9685	292	312	(K)DLYANTVLSGGTTMYPGIADR(M)	1Met-ox
2343.0980	2343.1655	-28.8064	291	312	(R)(M)
2564.1126	2564.1900	-30.1986	216	238	(K)LCYVALDFEQEMATAASSSSLEK(S)	1Cys-am
3183.5379	3183.6149	-24.1645	148	177	(R)(L)
3199.5977	3199.6098	-3.7623	148	177	(R)TTGIVMDSGDGVTHTVPIYEGYALPHAILR(L)	1Met-ox

Click link below to search for another component.

Click individual mass to do a non-specific cleavage search.

The matched peptides cover 55% (207/375AA's) of the protein.
Coverage Map for This Hit (MS-Digest index #):

Percent TIC = 33.3 Mean Error = -50.0244 ppm Data Tolerance = 39.1442 ppm Mean Missed Cleavages = 0.3

2. 20/60 matches (33%). 41793.2 Da, pI = 5.31. Acc. # P02571. HUMAN. ACTIN, CYTOPLASMIC 2 (GAMMA-ACTIN).

m/z
submitted MH⁺
matched Delta
ppm start end Peptide Sequence
(Click for Fragment Ions) Modifications
644.3322 644.3731 -63.5738 178 183 (R)(D)
791.3130 791.3722 -74.8168 285 290 (K)CDVDIR(K) 1Cys-am
795.4146 795.4729 -73.2587 329 335 (K)(K)
800.4780 800.5358 -72.1728 62 68 (K)(Y)
919.4116 919.4671 -60.3502 285 291 (K)CDVDIRK(D) 1Cys-am
923.5008 923.5678 -72.5851 329 336 (K)(Y)
976.3865 976.4488 -63.8378 19 28 (K)(A)
1132.4567 1132.5275 -62.5244 197 206 (R)(E)
1198.6349 1198.7061 -59.3741 29 39 (R)(H)
1354.5480 1354.6239 -56.0260 51 62 (K)(G)
1515.6824 1515.7497 -44.4241 85 95 (K)(V)
1790.7887 1790.8925 -57.9356 239 254 (K)(F)
1953.9859 1954.0650 -40.4360 96 113 (R)(A)
1982.8302 1982.8873 -28.8311 1 18 (-)MEEEIAALVIDNGSGMCK(A) 1Met-ox
2214.9895 2215.0705 -36.5764 292 312 (K)(M)
2230.9919 2231.0654 -32.9685 292 312 (K)DLYANTVLSGGTTMYPGIADR(M) 1Met-ox
2343.0980 2343.1655 -28.8064 291 312 (R)(M)
2564.1126 2564.1900 -30.1986 216 238 (K)LCYVALDFEQEMATAASSSSLEK(S) 1Cys-am
3183.5379 3183.6149 -24.1645 148 177 (R)(L)
3199.5977 3199.6098 -3.7623 148 177 (R)TTGIVMDSGDGVTHTVPIYEGYALPHAILR(L) 1Met-ox

Click link below to search for another component.

Click individual mass to do a non-specific cleavage search.

The matched peptides cover 55% (207/375AA's) of the protein.
Coverage Map for This Hit (MS-Digest index #):

Percent TIC = 33.3 Mean Error = -49.3312 ppm Data Tolerance = 40.1683 ppm Mean Missed Cleavages = 0.3

3. 14/60 matches (23%). 42019.4 Da, pI = 5.23. Acc. # P04270. HUMAN. ACTIN, ALPHA CARDIAC.

m/z
submitted MH⁺
matched Delta
ppm start end Peptide Sequence
(Click for Fragment Ions) Modifications
644.3322 644.3731 -63.5738 180 185 (R)(D)
791.3130 791.3722 -74.8168 287 292 (K)(K)
795.4146 795.4729 -73.2587 331 337 (K)(K)
800.4780 800.5358 -72.1728 64 70 (K)(Y)
919.4116 919.4671 -60.3502 287 293 (K)(D)
923.5008 923.5678 -72.5851 331 338 (K)(Y)
976.3865 976.4488 -63.8378 21 30 (K)(A)
1198.6349 1198.7061 -59.3741 31 41 (R)(H)
1354.5480 1354.6239 -56.0260 53 64 (K)(G)
1515.6824 1515.7497 -44.4241 87 97 (K)(V)
1790.7887 1790.8925 -57.9356 241 256 (K)(F)
1960.8186 1960.9115 -47.3945 71 86 (K)(I)
1976.8951 1976.9064 -5.7423 71 86 (K)YPIEHGIITNWDDMEK(I) 1Met-ox
3199.5977 3199.3982 62.3659 1 30 (-)MCDDEETTALVCDNGSGLVKAGFAGDDAPR(A) 2Cys-am

Click link below to search for another component.

Click individual mass to do a non-specific cleavage search.

m/z submitted	MH⁺ matched	Delta ppm	start	end	Peptide Sequence (Click for Fragment Ions)	Modifications
644.3322	644.3731	-63.5738	180	185	(R)(D)
791.3130	791.3722	-74.8168	287	292	(K)(K)
795.4146	795.4729	-73.2587	331	337	(K)(K)
800.4780	800.5358	-72.1728	64	70	(K)(Y)
919.4116	919.4671	-60.3502	287	293	(K)(D)
923.5008	923.5678	-72.5851	331	338	(K)(Y)
976.3865	976.4488	-63.8378	21	30	(K)(A)
1198.6349	1198.7061	-59.3741	31	41	(R)(H)
1354.5480	1354.6239	-56.0260	53	64	(K)(G)
1515.6824	1515.7497	-44.4241	87	97	(K)(V)
1790.7887	1790.8925	-57.9356	241	256	(K)(F)
1960.8186	1960.9115	-47.3945	71	86	(K)(I)
1976.8951	1976.9064	-5.7423	71	86	(K)YPIEHGIITNWDDMEK(I)	1Met-ox
3199.5977	3199.3982	62.3659	1	30	(-)MCDDEETTALVCDNGSGLVKAGFAGDDAPR(A)	2Cys-am

The matched peptides cover 32% (123/377AA's) of the protein.
Coverage Map for This Hit (MS-Digest index #):

Percent TIC = 23.3 Mean Error = -49.2233 ppm Data Tolerance = 73.2600 ppm Mean Missed Cleavages = 0.4

4. 14/60 matches (23%). 42051.4 Da, pI = 5.23. Acc. # P02568. HUMAN. ACTIN, ALPHA SKELETAL MUSCLE (ALPHA-ACTIN 1).

m/z
submitted MH⁺
matched Delta
ppm start end Peptide Sequence
(Click for Fragment Ions) Modifications
644.3322 644.3731 -63.5738 180 185 (R)(D)
791.3130 791.3722 -74.8168 287 292 (K)(K)
795.4146 795.4729 -73.2587 331 337 (K)(K)
800.4780 800.5358 -72.1728 64 70 (K)(Y)
919.4116 919.4671 -60.3502 287 293 (K)(D)
923.5008 923.5678 -72.5851 331 338 (K)(Y)
976.3865 976.4488 -63.8378 21 30 (K)(A)
1198.6349 1198.7061 -59.3741 31 41 (R)(H)
1354.5480 1354.6239 -56.0260 53 64 (K)(G)
1515.6824 1515.7497 -44.4241 87 97 (K)(V)
1790.7887 1790.8925 -57.9356 241 256 (K)(F)
1960.8186 1960.9115 -47.3945 71 86 (K)(I)
1976.8951 1976.9064 -5.7423 71 86 (K)YPIEHGIITNWDDMEK(I) 1Met-ox
3199.5977 3199.3982 62.3659 1 30 (-)MCDEDETTALVCDNGSGLVKAGFAGDDAPR(A) 2Cys-am

Click link below to search for another component.

Click individual mass to do a non-specific cleavage search.

m/z submitted	MH⁺ matched	Delta ppm	start	end	Peptide Sequence (Click for Fragment Ions)	Modifications
644.3322	644.3731	-63.5738	180	185	(R)(D)
791.3130	791.3722	-74.8168	287	292	(K)(K)
795.4146	795.4729	-73.2587	331	337	(K)(K)
800.4780	800.5358	-72.1728	64	70	(K)(Y)
919.4116	919.4671	-60.3502	287	293	(K)(D)
923.5008	923.5678	-72.5851	331	338	(K)(Y)
976.3865	976.4488	-63.8378	21	30	(K)(A)
1198.6349	1198.7061	-59.3741	31	41	(R)(H)
1354.5480	1354.6239	-56.0260	53	64	(K)(G)
1515.6824	1515.7497	-44.4241	87	97	(K)(V)
1790.7887	1790.8925	-57.9356	241	256	(K)(F)
1960.8186	1960.9115	-47.3945	71	86	(K)(I)
1976.8951	1976.9064	-5.7423	71	86	(K)YPIEHGIITNWDDMEK(I)	1Met-ox
3199.5977	3199.3982	62.3659	1	30	(-)MCDEDETTALVCDNGSGLVKAGFAGDDAPR(A)	2Cys-am

The matched peptides cover 32% (123/377AA's) of the protein.
Coverage Map for This Hit (MS-Digest index #):

Percent TIC = 23.3 Mean Error = -49.2233 ppm Data Tolerance = 73.2600 ppm Mean Missed Cleavages = 0.4

5. 12/60 matches (20%). 41877.3 Da, pI = 5.31. Acc. # P12718. HUMAN. ACTIN, GAMMA-ENTERIC SMOOTH MUSCLE (ALPHA-ACTIN 3).

m/z
submitted MH⁺
matched Delta
ppm start end Peptide Sequence
(Click for Fragment Ions) Modifications
644.3322 644.3731 -63.5738 179 184 (R)(D)
791.3130 791.3722 -74.8168 286 291 (K)(K)
795.4146 795.4729 -73.2587 330 336 (K)(K)
800.4780 800.5358 -72.1728 63 69 (K)(Y)
919.4116 919.4671 -60.3502 286 292 (K)(D)
923.5008 923.5678 -72.5851 330 337 (K)(Y)
976.3865 976.4488 -63.8378 20 29 (K)(A)
1198.6349 1198.7061 -59.3741 30 40 (R)(H)
1354.5480 1354.6239 -56.0260 52 63 (K)(G)
1790.7887 1790.8925 -57.9356 240 255 (K)(F)
1960.8186 1960.9115 -47.3945 70 85 (K)(I)
1976.8951 1976.9064 -5.7423 70 85 (K)YPIEHGIITNWDDMEK(I) 1Met-ox

Click link below to search for another component.

Click individual mass to do a non-specific cleavage search.

m/z submitted	MH⁺ matched	Delta ppm	start	end	Peptide Sequence (Click for Fragment Ions)	Modifications
644.3322	644.3731	-63.5738	179	184	(R)(D)
791.3130	791.3722	-74.8168	286	291	(K)(K)
795.4146	795.4729	-73.2587	330	336	(K)(K)
800.4780	800.5358	-72.1728	63	69	(K)(Y)
919.4116	919.4671	-60.3502	286	292	(K)(D)
923.5008	923.5678	-72.5851	330	337	(K)(Y)
976.3865	976.4488	-63.8378	20	29	(K)(A)
1198.6349	1198.7061	-59.3741	30	40	(R)(H)
1354.5480	1354.6239	-56.0260	52	63	(K)(G)
1790.7887	1790.8925	-57.9356	240	255	(K)(F)
1960.8186	1960.9115	-47.3945	70	85	(K)(I)
1976.8951	1976.9064	-5.7423	70	85	(K)YPIEHGIITNWDDMEK(I)	1Met-ox

The matched peptides cover 24% (92/376AA's) of the protein.
Coverage Map for This Hit (MS-Digest index #):

Percent TIC = 20.0 Mean Error = -58.9223 ppm Data Tolerance = 37.3622 ppm Mean Missed Cleavages = 0.3